PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa13g020270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 528aa    MW: 57728.1 Da    PI: 4.5812
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa13g020270.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS432.43.4e-1321615201374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv++L++cAeav++++l+la+al++r+  la++++ +m ++a+yf+eALa+r++r        ++ps+++ + s eel  +  f++ sP+lkf+h
  Csa13g020270.1 161 LVQALVACAEAVQQENLSLADALVKRVGSLAASQAGAMGKVATYFAEALARRIYR--------IHPSSAAVDPSFEEL-LQMNFYDSSPYLKFAH 246
                     689****************************************************........555555543444443.4446************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIleav  ++ vH+iD++++qG+QWpaL+qaLa Rp+gpps+R+Tgvg+p+  ++e ++e+g++La++A+++gv+fefn+++++rl+dle
  Csa13g020270.1 247 FTANQAILEAVTMARGVHVIDLGLNQGMQWPALMQALALRPGGPPSFRLTGVGAPS--NREGIQELGWKLAQLAQAVGVEFEFNAITTERLSDLE 339
                     ******************************************************88..9************************************ PP

            GRAS 191 leeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                      ++++++p  E+l+Vn+v++lh +l++++s+e+    +L +vk ++P +v+vveqea+hn+  Fl+rf eal+yys+lfdsle ++     ++++
  Csa13g020270.1 340 QDMFETRPaSETLVVNSVFELHPVLAQPGSIEK----LLATVKAVKPSIVTVVEQEANHNGVVFLDRFNEALHYYSSLFDSLEDSA-VIPGQDRV 429
                     *********************************....*********************************************9884.45577788 PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +++++lgr+i nvva+eg++r+erhetl +Wr+r+++aGF pv+l+++a kqa+lll+ ++ +dgyrvee++gsl+l W+++pLv++SaW+
  Csa13g020270.1 430 LSEVYLGRQILNVVAAEGTDRVERHETLDQWRRRMGSAGFDPVNLGYDAFKQASLLLALFGgGDGYRVEENDGSLMLAWQTKPLVAASAWK 520
                     89999*************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120415.9E-3038104IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011298.9E-3538111No hitNo description
PROSITE profilePS5098564.389135499IPR005202Transcription factor GRAS
PfamPF035141.2E-129161520IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MKRSHQETYL EQQEAPSMAE YGKKLEGSSV VGGDDSIDEL LAALGYKVRS SDMADVAHKL  60
EQLEMVLSND VVGSSNSFLN DTVHYNPSDL SSWAQTMLSG LTYYPDLDPT RVCDLRPITD  120
DDESCCSSNS NKRIRLGPWC DSVSSESTRS VVLIEETGIR LVQALVACAE AVQQENLSLA  180
DALVKRVGSL AASQAGAMGK VATYFAEALA RRIYRIHPSS AAVDPSFEEL LQMNFYDSSP  240
YLKFAHFTAN QAILEAVTMA RGVHVIDLGL NQGMQWPALM QALALRPGGP PSFRLTGVGA  300
PSNREGIQEL GWKLAQLAQA VGVEFEFNAI TTERLSDLEQ DMFETRPASE TLVVNSVFEL  360
HPVLAQPGSI EKLLATVKAV KPSIVTVVEQ EANHNGVVFL DRFNEALHYY SSLFDSLEDS  420
AVIPGQDRVL SEVYLGRQIL NVVAAEGTDR VERHETLDQW RRRMGSAGFD PVNLGYDAFK  480
QASLLLALFG GGDGYRVEEN DGSLMLAWQT KPLVAASAWK LAAELRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-551615204375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1172260.0AK117226.1 Arabidopsis thaliana At5g17490 mRNA for RGA-like protein, complete cds, clone: RAFL16-78-A02.
GenBankAL3911500.0AL391150.1 Arabidopsis thaliana DNA chromosome 5, BAC clone K3M16 (ESSA project).
GenBankBT0059050.0BT005905.1 Arabidopsis thaliana At5g17490 gene, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010453948.10.0PREDICTED: DELLA protein RGL3-like
SwissprotQ9LF530.0RGL3_ARATH; DELLA protein RGL3
TrEMBLR0H0W30.0R0H0W3_9BRAS; Uncharacterized protein
STRINGAT5G17490.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.10.0RGA-like protein 3